Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002288-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002288-M01, RRID:AB_534867
- Product name
- FKBP4 monoclonal antibody (M01), clone 5C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FKBP4.
- Antigen sequence
EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAF
SAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFE
LARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLA
REKKL- Isotype
- IgG
- Antibody clone number
- 5C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
Identification of a new panel of serum autoantibodies associated with the presence of in situ carcinoma of the breast in younger women.
Katsogiannou M, Andrieu C, Baylot V, Baudot A, Dusetti NJ, Gayet O, Finetti P, Garrido C, Birnbaum D, Bertucci F, Brun C, Rocchi P
Molecular & cellular proteomics : MCP 2014 Dec;13(12):3585-601
Molecular & cellular proteomics : MCP 2014 Dec;13(12):3585-601
Identification of a new panel of serum autoantibodies associated with the presence of in situ carcinoma of the breast in younger women.
Desmetz C, Bascoul-Mollevi C, Rochaix P, Lamy PJ, Kramar A, Rouanet P, Maudelonde T, Mangé A, Solassol J
Clinical cancer research : an official journal of the American Association for Cancer Research 2009 Jul 15;15(14):4733-41
Clinical cancer research : an official journal of the American Association for Cancer Research 2009 Jul 15;15(14):4733-41
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FKBP4 monoclonal antibody (M01), clone 5C11. Western Blot analysis of FKBP4 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FKBP4 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of FKBP4 transfected lysate using anti-FKBP4 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FKBP4 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to FKBP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 0.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol