Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486787 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-FK506 Binding Protein 4, 59kDa (FKBP4) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FKBP4 antibody: synthetic peptide directed towards the C terminal of human FKBP4
- Description
- Affinity Purified
- Reactivity
- Human, Porcine
- Host
- Rabbit
- Antigen sequence
ANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKS
NTAGS QSQVETEA- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Binding of rapamycin analogs to calcium channels and FKBP52 contributes to their neuroprotective activities.
Ruan B, Pong K, Jow F, Bowlby M, Crozier RA, Liu D, Liang S, Chen Y, Mercado ML, Feng X, Bennett F, von Schack D, McDonald L, Zaleska MM, Wood A, Reinhart PH, Magolda RL, Skotnicki J, Pangalos MN, Koehn FE, Carter GT, Abou-Gharbia M, Graziani EI
Proceedings of the National Academy of Sciences of the United States of America 2008 Jan 8;105(1):33-8
Proceedings of the National Academy of Sciences of the United States of America 2008 Jan 8;105(1):33-8
No comments: Submit comment
No validations: Submit validation data