HPA006148

FKBP4 antibody from Atlas Antibodies
FKBP52, FKBP59
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006148
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006148, RRID:AB_888401
Product name
Anti-FKBP4
Provider product page
Atlas Antibodies - HPA006148
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATL
VFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAK
PNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENL
DLPYGLERAIQRMEKGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -