H00051010-M03
antibody from Abnova Corporation
Targeting: EXOSC3
CGI-102, hRrp-40, hRrp40p, p10, RRP40, Rrp40p
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051010-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051010-M03, RRID:AB_565714
- Product name
- EXOSC3 monoclonal antibody (M03), clone 5C3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant EXOSC3.
- Antigen sequence
MAEPASVAAESLAGSRARAARTVLGQVVLPGEELL
LPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPG
LRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQ
QKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPAS
LSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDME
PEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKL
LAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQ
QTLILANILEACEHMTSDQRKQIFSRLAES- Isotype
- IgG
- Antibody clone number
- 5C3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- EXOSC3 monoclonal antibody (M03), clone 5C3 Western Blot analysis of EXOSC3 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of EXOSC3 expression in transfected 293T cell line by EXOSC3 monoclonal antibody (M03), clone 5C3.Lane 1: EXOSC3 transfected lysate (Predicted MW: 29.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged EXOSC3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of EXOSC3 transfected lysate using anti-EXOSC3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EXOSC3 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to EXOSC3 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol