HPA031763

MCOLN1 antibody from Atlas Antibodies

ML4, MLIV, MST080, MSTP080, TRPM-L1, TRPML1

Western blot: Supportive data in Antibodypedia

Immunocytochemistry: Supportive data in Antibodypedia

Immunohistochemistry: Enhanced validation

Provider product page for HPA031763

Antibody data

Antibody Data
References [0]
Comments [0]
Validations
Western blot [3]
Immunocytochemistry [1]
Immunohistochemistry [6]

Submit

Validation data

Product number: HPA031763
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA031763, RRID:AB_10600822
Product name: Anti-MCOLN1
Provider product page: Atlas Antibodies - HPA031763
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DTIKHPGGAGAEESELQAYIAQCQDSPTSGKFRRG SGSACSLLCCCGRDPSE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in mast cell.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no cytoplasmic positivity in endocrine glandular cells as expected.
Sample type: HUMAN

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and pancreas tissues using HPA031763 antibody. Corresponding MCOLN1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

: Show more