Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024160 - Provider product page

- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-WDR32 antibody produced in rabbit
- Antibody type
- Polyclonal
- Antigen
- WD repeat-containing protein 32 recombinant protein epitope signature tag (PrEST)
- Description
- affinity isolated antibody
- Reactivity
- Human
- Antigen sequence
GARLFGWLKERSLGRGLFVDPARDNFRTMTSLYGS
IHPADSVYLSTRTHGAVFNLEYSPDGSVLTVACEQ
TEVLL- Storage
- -20C
No comments: Submit comment
No validations: Submit validation data