HPA024160

DCAF10 antibody from Sigma-Aldrich
FLJ23201, MGC10765, WDR32
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024160
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024160, RRID:AB_1858802
Product name
Anti-WDR32 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024160
Antibody type
Polyclonal
Antigen
WD repeat-containing protein 32 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GARLFGWLKERSLGRGLFVDPARDNFRTMTSLYGS
IHPADSVYLSTRTHGAVFNLEYSPDGSVLTVACEQ
TEVLL
Storage
-20C
Provider Type Product Number
- No reagents -