HPA003996

RAB13 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003996
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003996, RRID:AB_1079728
Product name
Anti-RAB13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003996
Antibody type
Polyclonal
Antigen
Ras-related protein Rab-13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AMGIILVYDITDEKSFENIQNWMKSIKENASAGVE
RLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFET
SAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPP
STDLKTCDKKNTNKCS
Storage
-20C
Provider Type Product Number
- No reagents -