Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003941 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003941, RRID:AB_1079618
- Product name
- Anti-PIM1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLE
SQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVE
KDRISDWGELPNGTRVPMEVVLLKKVSSGFS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references PIM1 kinase promotes gallbladder cancer cell proliferation via inhibition of proline-rich Akt substrate of 40 kDa (PRAS40)
Subbannayya T, Leal-Rojas P, Zhavoronkov A, Ozerov I, Korzinkin M, Babu N, Radhakrishnan A, Chavan S, Raja R, Pinto S, Patil A, Barbhuiya M, Kumar P, Guerrero-Preston R, Navani S, Tiwari P, Kumar R, Prasad T, Roa J, Pandey A, Sidransky D, Gowda H, Izumchenko E, Chatterjee A
Journal of Cell Communication and Signaling 2019;13(2):163-177
Journal of Cell Communication and Signaling 2019;13(2):163-177
No comments: Submit comment
No validations: Submit validation data