H00000219-M02

ALDH1B1 antibody from Abnova Corporation
ALDH5, ALDHX
No application information provided.

Antibody data

Product number
H00000219-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000219-M02, RRID:AB_1237640
Product name
ALDH1B1 monoclonal antibody (M02), clone 2C7
Provider product page
Abnova Corporation - H00000219-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ALDH1B1.
Antigen sequence
MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIP
YNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAE
GDRADVDRAVKAAREAFRLGSPWRRMDASERGRLL
NLLADLVERDRVYLASLETLDNGKPFQESYALDLD
EVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEP
VGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKV
AEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTA
GAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLK
RVTLELGGKSPSIVLADADMEHAVEQCHEALFFNM
GQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGN
PFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLL
CGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDK
AMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGN
GRELGEDGLKAYTEVKTVTIKVPQKNS
Isotype
IgG
Antibody clone number
2C7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -