HPA024313

PPP1R42 antibody from Atlas Antibodies
dtr, LRRC67, TLLR
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024313
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024313, RRID:AB_1853053
Product name
Anti-PPP1R42
Provider product page
Atlas Antibodies - HPA024313
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HSLAKSLCILNISNNNIDDITDLELLENLNQLIAV
DNQLLHVKDLEFLLNKLMKLWKIDLNGNPVCLKPK
YRDRLILVSKSLGT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -