Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028628 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA028628, RRID:AB_2250064
- Product name
- Anti-PPP1R42
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MVRLTLDLIARNSNLKPRKEETISQCLKKITHINF
SDKNIDAIEDLSLCKNLSVLYLYDNCISQITNLNY
ATN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references PPP1R42, a PP1 binding protein, regulates centrosome dynamics in ARPE-19 cells.
DeVaul N, Wang R, Sperry AO
Biology of the cell 2013 Aug;105(8):359-71
Biology of the cell 2013 Aug;105(8):359-71
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-PPP1R42 antibody HPA028628 (A) shows similar pattern to independent antibody HPA027983 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows moderate nuclear positivity in glandular cells.
- Sample type
- HUMAN