HPA027983

PPP1R42 antibody from Sigma-Aldrich
dtr, LRRC67, TLLR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027983
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027983, RRID:AB_10599300
Product name
Anti-LRRC67 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027983
Antibody type
Polyclonal
Antigen
leucine rich repeat containing 67 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTHLYLQNNCISCIENLRSLKKLEKLYLGGNYIAV
IEGLEGLGELRELHVENQRLPLGEKLLFDPRTL
Storage
-20C
Provider Type Product Number
- No reagents -