HPA002237

HS3ST1 antibody from Sigma-Aldrich
3OST1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002237
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002237, RRID:AB_1079085
Product name
Anti-HS3ST1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002237
Antibody type
Polyclonal
Antigen
Heparan sulfate glucosamine 3-O-sulfotransferase 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALN
RSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPE
IQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGR
DRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFF
ELVGR
Storage
-20C
Provider Type Product Number
- No reagents -