H00010457-M09

GPNMB antibody from Abnova Corporation
HGFIN, NMB
No application information provided.

Antibody data

Product number
H00010457-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010457-M09, RRID:AB_1575261
Product name
GPNMB monoclonal antibody (M09), clone 3A5
Provider product page
Abnova Corporation - H00010457-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant GPNMB.
Antigen sequence
MECLYYFLGFLLLAARLPLDAAKRFHDVLGNERPS
AYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWK
NSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRC
QKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSE
DSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIY
VFHTLGQYFQKLGRCSVRVSVNTANVTLGPQLMEV
TVYRRHGRAYVPIAQVKDVYVVTDQIPVFVTMFQK
NDRNSSDETFLKDLPIMFDVLIHDPSHFLNYSTIN
YKWSFGDNTGLFVSTNHTVNHTYVLNGTFSLNLTV
KAAAPGPCPPPPPPPRPSKPTPSLATTLKSYDSNT
PGPAGDNPLELSRIPDENCQINRYGHFQATITIVE
GILEVNIIQMTDVLMPVPWPESSLIDFVVTCQGSI
PTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVR
RTFNGSGTYCVNLTLGDDTSLALTSTLISVPDRDP
ASPLRMANSALISVGCLAIFVTVISLLVYKKHKEY
NPIENSPGNVVRSKGLSVFLNRAKAVFFPGNQEKD
PLLKNQEFKGVS
Isotype
IgG
Antibody clone number
3A5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -