AV44499

GPNMB antibody from Sigma-Aldrich
HGFIN, NMB
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV44499
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV44499, RRID:AB_1849935
Product name
Anti-GPNMB antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV44499
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human GPNMB with an internal ID of P12015
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQ
KEDANGNIVYEKNCR
Storage
-20C
Provider Type Product Number
- No reagents -