HPA045271

SMN1 antibody from Atlas Antibodies
BCD541, GEMIN1, SMA, SMA@, SMA1, SMA2, SMA3, SMNT, TDRD16A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA045271
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA045271, RRID:AB_2679280
Product name
Anti-SMN1
Provider product page
Atlas Antibodies - HPA045271
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASF
KHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNT
AASLQQWKVGDKCSAIWSEDGCIYP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -