Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182479 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-NGFI-A Binding Protein 1 (EGR1 Binding Protein 1) (NAB1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NAB1 antibody: synthetic peptide directed towards the N terminal of human NAB1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPT
WLGIS CSSYERSSNA- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Early growth response-1 induces and enhances vascular endothelial growth factor-A expression in lung cancer cells.
Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
Shimoyamada H, Yazawa T, Sato H, Okudela K, Ishii J, Sakaeda M, Kashiwagi K, Suzuki T, Mitsui H, Woo T, Tajiri M, Ohmori T, Ogura T, Masuda M, Oshiro H, Kitamura H
The American journal of pathology 2010 Jul;177(1):70-83
The American journal of pathology 2010 Jul;177(1):70-83
Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
Brandenberger R, Wei H, Zhang S, Lei S, Murage J, Fisk GJ, Li Y, Xu C, Fang R, Guegler K, Rao MS, Mandalam R, Lebkowski J, Stanton LW
Nature biotechnology 2004 Jun;22(6):707-16
Nature biotechnology 2004 Jun;22(6):707-16
No comments: Submit comment
No validations: Submit validation data