Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487154 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-NGFI-A Binding Protein 1 (EGR1 Binding Protein 1) (NAB1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NAB1 antibody: synthetic peptide directed towards the C terminal of human NAB1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VVDGELSRLYPSEAKSHSSESLGILKDYPHSAFTL
EKKVI KTEPEDSR- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The glucocorticoid receptor gene exon 1-F promoter is not methylated at the NGFI-A binding site in human hippocampus.
Moser D, Molitor A, Kumsta R, Tatschner T, Riederer P, Meyer J
The world journal of biological psychiatry : the official journal of the World Federation of Societies of Biological Psychiatry 2007;8(4):262-8
The world journal of biological psychiatry : the official journal of the World Federation of Societies of Biological Psychiatry 2007;8(4):262-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting