HPA002570

TRIP11 antibody from Atlas Antibodies
CEV14, GMAP-210, GMAP210, Trip230
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002570
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002570, RRID:AB_1078995
Product name
Anti-TRIP11
Provider product page
Atlas Antibodies - HPA002570
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAE
LPDSRTKEIEAIHAILRSENERLKKLCTDLEEKHE
ASEIQIKQQSTSYRNQLQQKEVEISHLKARQIALQ
DQLLKLQSAAQSVPSGAGVPATTASSSFAY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -