HPA002570

TRIP11 antibody from Sigma-Aldrich
CEV14, GMAP-210, GMAP210, Trip230
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002570
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002570, RRID:AB_1078995
Product name
Anti-TRIP11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002570
Antibody type
Polyclonal
Antigen
Thyroid receptor-interacting protein 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAE
LPDSRTKEIEAIHAILRSENERLKKLCTDLEEKHE
ASEIQIKQQSTSYRNQLQQKEVEISHLKARQIALQ
DQLLKLQSAAQSVPSGAGVPATTASSSFAY
Storage
-20C
Provider Type Product Number
- No reagents -