Antibody data

Product number
H00115416-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00115416-B01, RRID:AB_1204041
Product name
C7orf30 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00115416-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C7orf30 protein.
Antigen sequence
MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLR
LLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEER
AEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQEN
ARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAF
YVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSM
VIHLMLPETREIYELEKLWTLRSYDDQLAQIAPET
VPEDFILGIEDDTSSVTPVELKCE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -