HPA014845

MPDU1 antibody from Sigma-Aldrich
CDGIf, Lec35, PQLC5, SL15, SLC66A5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014845
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014845, RRID:AB_1854072
Product name
Anti-MPDU1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014845
Antibody type
Polyclonal
Antigen
Mannose-P-dolichol utilization defect 1 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPC
LKILLSK
Storage
-20C
Provider Type Product Number
- No reagents -