HPA048751

XAB2 antibody from Atlas Antibodies
HCNP, HCRN, NTC90, SYF1

Antibody data

Product number
HPA048751
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA048751, RRID:AB_2680512
Product name
Anti-XAB2
Provider product page
Atlas Antibodies - HPA048751
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLW
LDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRI
WPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEY
IEYLKSSDRLD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -