Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183005 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-APG4B antibody: synthetic peptide directed towards the C terminal of human APG4B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LGGALPMFELVELQPSHLACPDVLNLSLDSSDVER
LERFF DSEDEDFEIL- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references HsAtg4B/HsApg4B/autophagin-1 cleaves the carboxyl termini of three human Atg8 homologues and delipidates microtubule-associated protein light chain 3- and GABAA receptor-associated protein-phospholipid conjugates.
Tanida I, Sou YS, Ezaki J, Minematsu-Ikeguchi N, Ueno T, Kominami E
The Journal of biological chemistry 2004 Aug 27;279(35):36268-76
The Journal of biological chemistry 2004 Aug 27;279(35):36268-76
No comments: Submit comment
No validations: Submit validation data