Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182950 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-COP9 Constitutive Photomorphogenic Homolog Subunit 2 (Arabidopsis) (COPS2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-COPS2 antibody: synthetic peptide directed towards the N terminal of human COPS2
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQ
YYNSK ALKEDDPKAA- Vial size
- 50 µg
Submitted references Cellular senescence bypass screen identifies new putative tumor suppressor genes.
The highly conserved region of the co-repressor Sin3A functionally interacts with the co-repressor Alien.
Leal JF, Fominaya J, Cascón A, Guijarro MV, Blanco-Aparicio C, Lleonart M, Castro ME, Ramon Y Cajal S, Robledo M, Beach DH, Carnero A
Oncogene 2008 Mar 27;27(14):1961-70
Oncogene 2008 Mar 27;27(14):1961-70
The highly conserved region of the co-repressor Sin3A functionally interacts with the co-repressor Alien.
Moehren U, Dressel U, Reeb CA, Väisänen S, Dunlop TW, Carlberg C, Baniahmad A
Nucleic acids research 2004;32(10):2995-3004
Nucleic acids research 2004;32(10):2995-3004
No comments: Submit comment
No validations: Submit validation data