HPA016867

COPS2 antibody from Sigma-Aldrich
ALIEN, CSN2, TRIP15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016867
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016867, RRID:AB_1858336
Product name
Anti-COPS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016867
Antibody type
Polyclonal
Antigen
COP9 signalosome complex subunit 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFF
EAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPF
DSQEAKPYKNDPEILAMT
Storage
-20C
Provider Type Product Number
- No reagents -