Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00022919-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00022919-M02, RRID:AB_1204665
- Product name
- MAPRE1 monoclonal antibody (M02), clone 4F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAPRE1.
- Antigen sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKI
EQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHE
YIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNF
EFVQW- Isotype
- IgG
- Antibody clone number
- 4F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteomic analysis of the effects of the immunomodulatory mycotoxin deoxynivalenol.
Nogueira da Costa A, Mijal RS, Keen JN, Findlay JB, Wild CP
Proteomics 2011 May;11(10):1903-14
Proteomics 2011 May;11(10):1903-14
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MAPRE1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol