HPA003600

MAPRE1 antibody from Sigma-Aldrich
EB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003600
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003600, RRID:AB_1079309
Product name
Anti-MAPRE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003600
Antibody type
Polyclonal
Antigen
Microtubule-associated protein RP/EB family member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAA
APKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLT
VEDLEKERDFYFGKLRNIELICQENEGENDPVLQR
IVDILYATDEGFVIPDE
Storage
-20C
Provider Type Product Number
- No reagents -