HPA026792

IQCK antibody from Atlas Antibodies
FLJ36575, MGC35048
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026792
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026792, RRID:AB_1853889
Product name
Anti-IQCK
Provider product page
Atlas Antibodies - HPA026792
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSI
PFVEERLKQHPRPPIPLSLLLTEEEAALYIQSFWR
ACVVRCDPEIQELRQWQKKLREAKHIHQQVKIFWA
KQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -