Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504667 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-General Transcription Factor IIH, Polypeptide 2, 44kDa (GTF2H2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the middle region of human GTF2H2
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
HHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHV
YVCAV CQNVFCVDCD- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Impairment of alveolar macrophage transcription in idiopathic pulmonary fibrosis.
Ren P, Rosas IO, Macdonald SD, Wu HP, Billings EM, Gochuico BR
American journal of respiratory and critical care medicine 2007 Jun 1;175(11):1151-7
American journal of respiratory and critical care medicine 2007 Jun 1;175(11):1151-7
No comments: Submit comment
No validations: Submit validation data