ABIN406779

GTF2H2 antibody from antibodies-online
BTF2, BTF2P44, p44, T-BTF2P44, TFIIH

Antibody data

Product number
ABIN406779
Provider
antibodies-online
Product name
anti-General Transcription Factor IIH, Polypeptide 2, 44kDa (GTF2H2) antibody
Provider product page
antibodies-online - ABIN406779
Antibody type
Polyclonal
Antigen
The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the N terminal of human GTF2H2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
DILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRT
MEDQD LKPNRLTCTL
Vial size
50 μg
Storage
Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Provider Type Product Number
- No reagents -