HPA026883

CCDC126 antibody from Sigma-Aldrich
FLJ23031
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026883
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026883, RRID:AB_1846131
Product name
Anti-CCDC126 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026883
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 126 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKLREQILDLSKRYVKALAEENKNTVDVENGASMA
GYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGS
AANTTNGTSGNLVPVTTNKRTNVSGSI
Storage
-20C
Provider Type Product Number
- No reagents -