SAB1400762

CCDC126 antibody from Sigma-Aldrich
FLJ23031
ELISA
Recommended by provider

Antibody data

Product number
SAB1400762
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400762, RRID:AB_1853220
Product name
Anti-LOC90693 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400762
Antibody type
Polyclonal
Antigen
LOC90693 (NP_620126, a.a. 1-140) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQ
QPRHQSSVKLREQILDLSKRYVKALAEENKNTVDV
ENGASMAGYADLKRTIAVLLDDILQRLVKLENKVD
YIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSIR
(without GST)
Storage
-20C
Provider Type Product Number
- No reagents -