Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011004-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011004-M01, RRID:AB_425877
- Product name
- KIF2C monoclonal antibody (M01), clone 1G2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KIF2C.
- Antigen sequence
MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVN
LEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQ
LLPLHPKDNLPLQENVTIQKQKRRSVNSKI- Isotype
- IgG
- Antibody clone number
- 1G2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Mitotic rounding alters cell geometry to ensure efficient bipolar spindle formation.
Functional and spatial regulation of mitotic centromere-associated kinesin by cyclin-dependent kinase 1.
Lancaster OM, Le Berre M, Dimitracopoulos A, Bonazzi D, Zlotek-Zlotkiewicz E, Picone R, Duke T, Piel M, Baum B
Developmental cell 2013 May 13;25(3):270-83
Developmental cell 2013 May 13;25(3):270-83
Functional and spatial regulation of mitotic centromere-associated kinesin by cyclin-dependent kinase 1.
Sanhaji M, Friel CT, Kreis NN, Krämer A, Martin C, Howard J, Strebhardt K, Yuan J
Molecular and cellular biology 2010 Jun;30(11):2594-607
Molecular and cellular biology 2010 Jun;30(11):2594-607
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- KIF2C monoclonal antibody (M01), clone 1G2 Western Blot analysis of KIF2C expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of KIF2C expression in transfected 293T cell line by KIF2C monoclonal antibody (M01), clone 1G2.Lane 1: KIF2C transfected lysate(81.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged KIF2C is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to KIF2C on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of KIF2C transfected lysate using anti-KIF2C monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with KIF2C MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to KIF2C on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol