HPA006432

KIF2C antibody from Sigma-Aldrich
CT139, KNSL6, MCAK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006432
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006432, RRID:AB_1079331
Product name
Anti-KIF2C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006432
Antibody type
Polyclonal
Antigen
Kinesin-like protein KIF2C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGA
LIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAM
EELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAE
SALAQQAKHFSALR
Storage
-20C
Provider Type Product Number
- No reagents -