HPA057096

SAT2 antibody from Atlas Antibodies
SSAT2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA057096
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA057096, RRID:AB_2683334
Product name
Anti-SAT2
Provider product page
Atlas Antibodies - HPA057096
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRLIRELAEFEKLSDQVKISEEALRADGFGDNPFY
HCLV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -