HPA022136

SAT2 antibody from MilliporeSigma / Merck KGaA
SSAT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022136
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-SAT2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA022136
Antibody type
Polyclonal
Antigen
Diamine acetyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLA
VLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEA
TRKLAGK
Storage
-20C