HPA022136

SAT2 antibody from Sigma-Aldrich
SSAT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022136
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022136, RRID:AB_1856592
Product name
Anti-SAT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022136
Antibody type
Polyclonal
Antigen
Diamine acetyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLA
VLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEA
TRKLAGK
Storage
-20C
Provider Type Product Number
- No reagents -