SAB1400773

SAT2 antibody from Sigma-Aldrich
SSAT2
ELISA
Recommended by provider

Antibody data

Product number
SAB1400773
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400773, RRID:AB_1856591
Product name
Anti-SAT2 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400773
Antibody type
Polyclonal
Antigen
SAT2 (NP_597998.1, a.a. 1-170) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVK
ISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPC
VVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGI
GSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLY
KALGAQDLTEAEGWHFFCFQGEATRKLAGK (wit
hout GST)
Storage
-20C
Provider Type Product Number
- No reagents -