HPA019719

FAM221A antibody from Sigma-Aldrich
C7orf46, DKFZp686F0810, FLJ45875, MGC72075
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019719
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019719, RRID:AB_1853910
Product name
Anti-C7orf46 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019719
Antibody type
Polyclonal
Antigen
Uncharacterized protein C7orf46 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPV
GQDIPYAAMGGLTGFSSLAEGYMRLDDSGIGVP
Storage
-20C
Provider Type Product Number
- No reagents -