HPA024107

C1QTNF12 antibody from Atlas Antibodies
ADIPOLIN, C1QDC2, CTRP12, FAM132A, MGC105127
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024107
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024107, RRID:AB_2101207
Product name
Anti-C1QTNF12
Provider product page
Atlas Antibodies - HPA024107
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGP
PGPPGAEVTAETLLHEFQELLKEATERRFSGLLD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -