HPA024107

C1QTNF12 antibody from Sigma-Aldrich
ADIPOLIN, C1QDC2, CTRP12, FAM132A, MGC105127
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024107
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024107, RRID:AB_2101207
Product name
Anti-FAM132A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024107
Antibody type
Polyclonal
Antigen
Protein FAM132A Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGP
PGPPGAEVTAETLLHEFQELLKEATERRFSGLLD
Storage
-20C
Provider Type Product Number
- No reagents -