Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504503 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Budding Uninhibited By Benzimidazoles 3 Homolog (Yeast) (BUB3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BUB3 antibody: synthetic peptide directed towards the N terminal of human BUB3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSW
DTSVR LYDVPANSMR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic variation in the major mitotic checkpoint genes does not affect familial breast cancer risk.
Vaclavicek A, Bermejo JL, Wappenschmidt B, Meindl A, Sutter C, Schmutzler RK, Kiechle M, Bugert P, Burwinkel B, Bartram CR, Hemminki K, Försti A
Breast cancer research and treatment 2007 Dec;106(2):205-13
Breast cancer research and treatment 2007 Dec;106(2):205-13
No comments: Submit comment
No validations: Submit validation data