HPA003601

BUB3 antibody from Atlas Antibodies
BUB3L
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA003601
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003601, RRID:AB_888631
Product name
Anti-BUB3
Provider product page
Atlas Antibodies - HPA003601
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YQTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEV
QKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTF
ATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAF
SNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDA
ETKPKSP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -