HPA003601

BUB3 antibody from Atlas Antibodies
BUB3L
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003601
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003601, RRID:AB_1078309
Product name
Anti-BUB3
Provider product page
Atlas Antibodies - HPA003601
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YQTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEV
QKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTF
ATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAF
SNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDA
ETKPKSP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -