HPA003601

BUB3 antibody from Sigma-Aldrich
BUB3L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003601
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003601, RRID:AB_1078309
Product name
Anti-BUB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003601
Antibody type
Polyclonal
Antigen
Mitotic checkpoint protein BUB3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YQTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEV
QKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTF
ATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAF
SNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDA
ETKPKSP
Storage
-20C
Provider Type Product Number
- No reagents -