HPA023194

STK31 antibody from Atlas Antibodies
SgK396, TDRD8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023194
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023194, RRID:AB_1857590
Product name
Anti-STK31
Provider product page
Atlas Antibodies - HPA023194
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HEREEYEMLTSLAQKWFPELPLLHPEIGLLKYMNS
GGLLTMSLERDLLDAEPMKELSSKRPLVRSEVNGQ
IILLKGYSVDVDTEAKVIERAATYHRAWREAEGDS
GLLPLIF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -