HPA023194

STK31 antibody from MilliporeSigma / Merck KGaA
SgK396, TDRD8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023194
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023194, RRID:AB_1857590
Product name
Anti-STK31 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023194
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase 31 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HEREEYEMLTSLAQKWFPELPLLHPEIGLLKYMNS
GGLLTMSLERDLLDAEPMKELSSKRPLVRSEVNGQ
IILLKGYSVDVDTEAKVIERAATYHRAWREAEGDS
GLLPLIF
Storage
-20C
Provider Type Product Number
- No reagents -