HPA008419

BUB1B antibody from Sigma-Aldrich
Bub1A, BUBR1, MAD3L, SSK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008419
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008419, RRID:AB_1078308
Product name
Anti-BUB1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008419
Antibody type
Polyclonal
Antigen
Mitotic checkpoint serine/threonine-protein kinase BUB1 beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCK
IEPSINHILSTRKPGKEEGDPLQRVQSHQQASEEK
KEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQ
REAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQE
RTGD
Storage
-20C
Provider Type Product Number
- No reagents -