HPA046596

GPR139 antibody from Atlas Antibodies
PGR3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA046596
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA046596, RRID:AB_2679713
Product name
Anti-GPR139
Provider product page
Atlas Antibodies - HPA046596
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSIT
SSPWISPANSHCIKMLVYQYDK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -