HPA005471

PSMC4 antibody from Atlas Antibodies
MGC13687, MGC23214, MGC8570, MIP224, S6, TBP-7, TBP7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005471
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005471, RRID:AB_1855838
Product name
Anti-PSMC4
Provider product page
Atlas Antibodies - HPA005471
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHF
ELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHT
TAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENA
PAIIFIDEIDAIATKRFDAQTGADREVQRILLEL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -