ABIN504058
antibody from antibodies-online
Targeting: PSMC4
MGC13687, MGC23214, MGC8570, MIP224, S6, TBP-7, TBP7
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504058 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 4 (PSMC4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PSMC4 antibody: synthetic peptide directed towards the N terminal of human PSMC4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPE
DLEDL YSRYKKLQQE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The proteasomal subunit S6 ATPase is a novel synphilin-1 interacting protein--implications for Parkinson's disease.
Marx FP, Soehn AS, Berg D, Melle C, Schiesling C, Lang M, Kautzmann S, Strauss KM, Franck T, Engelender S, Pahnke J, Dawson S, von Eggeling F, Schulz JB, Riess O, Krüger R
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2007 Jun;21(8):1759-67
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2007 Jun;21(8):1759-67
No comments: Submit comment
No validations: Submit validation data